DPCstruct | MC60856
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 173 ± 19 aa |
| Standard deviation of domain lengths | 19.19 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E7M835 | 32-208 | PELQPVDIMTYPVIEGSAEAIGLLDLVNDESTTFDVLDDDVPLDRRAAGNIVAHRDGGDRLWGTSDDDLFESVEELDSVRWVGTRTI… |
| A0A5B8XUG5 | 314-463 | VVHQMLELANTATFEELDIWVGLDIRAAQIIVDTRRTTPFNTLQQLKDVPYIGPVSVMKMYDYLYKTGRCPVEFDDNGVVNAQCRPV… |
| A0A2T4VEI1 | 165-309 | None |
| A0A2E7ULW8 | 21-199 | None |
| A0A7V9TG14 | 529-681 | None |
| A0A7K4DV58 | 174-330 | None |
| A0A7Z9KXK3 | 116-294 | None |
| A0A7Z9G8Q0 | 766-945 | None |
| A0A661NHN4 | 12-192 | None |
| F8C8H0 | 1-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.