DPCstruct | MC60851
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 75 ± 11 aa |
| Standard deviation of domain lengths | 10.62 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S2WSE2 | 1-78 | MPHKYAKSKSWHVPKQQYKITNWSEYNQSLKNRGSIDIWLSKEAIAKWYEADQQNIGDGTPQQYTDFAIRICHETWIS |
| A0A261KRC8 | 3-66 | KSKSKSKYRVSNWSEYDASLRQRGSLTFWLNQEVIEQWLNQEKTGRKGASNTYSNVAIELMATL |
| A0A402W8Q4 | 52-127 | None |
| A0A349ME84 | 32-96 | None |
| A0A811CXB2 | 1-56 | None |
| A0A4R3F149 | 1-78 | None |
| F7XBM5 | 1-78 | None |
| A9EGP7 | 1-78 | None |
| A0A2N6IJN9 | 1-91 | None |
| A0A7W5CZP5 | 1-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.