DPCstruct | MC6085
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 487 ± 46 aa |
| Standard deviation of domain lengths | 46.33 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03707 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G4KQ03 | 4-533 | PSVEDLLLRYEGHIVPRSFNAGFITLSYVVSLIGAACTLELLNRRTSHKGKFNHLLLVSSAVAMGGIAIWCMHFIGNRALDLGNGEP… |
| A0A2K0WSS2 | 1-481 | MGGVAIWCMHFTGNKAIYLANGEPEMQVAYSKGFTALSFFIPILFLLSAFLAIGTNNAISWWRVIAGGVLCGISICGMHYLGNTSIK… |
| I1C6U1 | 2-547 | None |
| A0A507EXI1 | 2-477 | None |
| A0A420Q540 | 12-411 | None |
| W9JBF6 | 64-545 | None |
| A0A420QQ02 | 8-447 | None |
| A0A367JK20 | 6-536 | None |
| B6Q501 | 14-508 | None |
| A0A7H8RF79 | 1-515 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.