DPCstruct | MC60847
Metacluster Properties and Pfam Annotations
| Number of structural domains | 156 |
|---|---|
| Mean domain length (aa) | 103 ± 23 aa |
| Standard deviation of domain lengths | 23.36 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 85.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 21.48 |
| Pfam Score | 97.44 |
| Assigned Pfam label(s) | CL0530- CL0072- CL0280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A532DXR8 | 2-106 | FLRLYLDEDVSVLVADLIRAHGFDVKTTREAQNLGHSDLEQLVFSTTEQRTLLTHNRGDFERLHTEVLHQHKPHAGILIASRRASDF… |
| A0A7Z9WQJ0 | 1-98 | MRFLADESCDFAVVRTLQSERYDVLAVSEARPGVEDQYIIELAKQEGRILLTEDKDFGRLVYLAGAPEVGVILLRFPAKARGELCDA… |
| A0A4Y7J6N6 | 197-276 | None |
| A0A1F2P6W7 | 2-80 | None |
| A0A848A8X3 | 1-76 | None |
| A0A832FD53 | 98-179 | None |
| M2ZUU1 | 190-269 | None |
| A0A1M5Q7W2 | 79-166 | None |
| A0A7C1Q8T4 | 5-87 | None |
| A0A450SVA8 | 1-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.