DPCstruct | MC60845
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 115 ± 17 aa |
| Standard deviation of domain lengths | 16.90 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 29.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A348MYC9 | 99-192 | WTEESCKESALQFTTRKAWQKGAAGAYKASKRQGWFDNCVTHMSLQLRPKLDIEDCKVSASKYNTRKEWAKADPSAYQASRKSGWLE… |
| A0A4U1C4W8 | 1-121 | MVEIKKPNNFWNLEMCLDEAKQYSTYIEFQKKSSSAYGAALKNSWLKLIQENFKEIKKPNGYWTYELCELEAKKYKNKNQFRKGSSA… |
| A0A2Z4JTP2 | 1-110 | None |
| A0A2E2EIU8 | 1-100 | None |
| A0A1J0D7Q5 | 1-133 | None |
| A0A0Q9Y8Y8 | 98-200 | None |
| A0A414WNZ8 | 345-458 | None |
| A0A6M9PYD9 | 3-103 | None |
| A0A3D8M2X2 | 3-117 | None |
| A0A2E9XEL3 | 140-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.