DPCstruct | MC6084
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 264 ± 15 aa |
| Standard deviation of domain lengths | 14.52 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 81.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 23.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9WYK7 | 1-285 | MHQEHNLPWNTVASHLEFVYDNPHYTPRKTGLFANRVTSATQDKDTIFFLRNLTSTISRFSHTERGKYPTQAYTLPMSGDLFPDEMC… |
| A0A2K0WJ25 | 28-291 | ENQLPWEDLASVFQLKHTNTCQHGAYNLHVLAQPDSKTKLANFLDAFMRSVGEEFIRQRKQYPQKYCVPNEDEVIISDAVAANITPT… |
| A0A319E011 | 1-258 | None |
| A0A1L9UYC1 | 57-302 | None |
| A0A101MS04 | 2-247 | None |
| A0A1R3RXA1 | 1-263 | None |
| A0A093V555 | 583-863 | None |
| A0A1J9PTX5 | 576-858 | None |
| A0A1Y1YEB5 | 1-248 | None |
| B8MGD7 | 42-297 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.