DPCstruct | MC60837
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 89 ± 7 aa |
| Standard deviation of domain lengths | 6.96 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 20.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S2F8W2 | 1-87 | MKRYTTNKHPVLTIHAKVAAKSEQPYTPVPGYEPSSPLFEVAFETANGPLVFEVDRYAYPLFEVGMEGELVYQGPEIVSFEPWIHAK |
| A0A7X5BJH1 | 2-76 | NAPQRQAFVTILDKQIIDIPHPLPDQEDQEYWIYVQKGLGPKREFQVGPHYFHALKPGDQGELTYQGRKFLHFAL |
| A0A7C5FQF5 | 31-120 | None |
| A0A1Q9YLL2 | 11-105 | None |
| A0A094IJN8 | 3-101 | None |
| A0A1Y4EP89 | 85-172 | None |
| A0A2N2E6F0 | 22-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.