DPCstruct | MC60831
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 158 ± 18 aa |
| Standard deviation of domain lengths | 17.75 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0RER1 | 2-150 | ALPGRLDKRLLELDEDAAVRPAKIKVLEHGWWRSSRRGLLAKPRSELMTEGAREAAKREAFDLLDALTRSGALPLEDTALHVVLAAQ… |
| A0A812RPI8 | 931-1081 | RDYTKVPKQMDAQFETLAPDSALRPTIINPGVCWTKRSQKALLAQPVTSTLFFDDQKAEKDAAFDLLDAITKSGALPLSHAALHIVI… |
| A0A7S0IRH1 | 63-226 | None |
| A0A7S3ZQE7 | 805-977 | None |
| A0A7S4PGM3 | 22-185 | None |
| A0A7S4NWB8 | 174-334 | None |
| K0SDH8 | 486-661 | None |
| A0A7S4NX24 | 85-239 | None |
| A0A812U839 | 386-529 | None |
| A0A7S4NWU7 | 81-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.