DPCstruct | MC60827
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 53 ± 4 aa |
| Standard deviation of domain lengths | 4.03 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 72.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00504 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K7VK58 | 14-64 | GSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRE |
| A0A446W3J8 | 13-64 | SASPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFSKNRE |
| V4KJK0 | 5-68 | None |
| A0A834ZF12 | 26-83 | None |
| A0A7J7E2I8 | 46-97 | None |
| A0A835IMY6 | 9-58 | None |
| A0A7N0T4A9 | 47-98 | None |
| A0A2K1IZ77 | 86-135 | None |
| A0A287R978 | 114-167 | None |
| A0A200PQD7 | 47-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.