DPCstruct | MC60826
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 111 ± 9 aa |
| Standard deviation of domain lengths | 9.05 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 34.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0QPS2 | 7-105 | SSNVLDSMMENGTFDKFRENIVNQLKDNEELRSYTSDLVKKSQTLNAADARGQQKKILFEKLRSEIENKVMERASEAAWDILLSEEG… |
| A0A1Y1HVR4 | 2-111 | QVLNQLMDNGLFDTLRKSITAELESNMELKKFTTAEVERSQVLQAPGAERRSRRELFEALRRELQSKVLERASEAAWNAILSKDSVG… |
| A0A0K9RH22 | 1-121 | None |
| C1N0I3 | 22-117 | None |
| I0YJU0 | 1-123 | None |
| A0A835M6G3 | 1-109 | None |
| A0A7S0KJJ8 | 16-127 | None |
| A0A5J4Y1H9 | 5-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.