DPCstruct | MC60825
Metacluster Properties and Pfam Annotations
| Number of structural domains | 147 |
|---|---|
| Mean domain length (aa) | 173 ± 32 aa |
| Standard deviation of domain lengths | 32.00 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 18.86 |
| Pfam Score | 95.98 |
| Assigned Pfam label(s) | CL0167- CL0021- PF21010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0N853 | 10-176 | SGNAALLRAVTCAGLYPRVCKAEKVRGKDSSYEKLSVGPTWQQVWMHPSSICSSDSQRLVGNTPQDGWYVFEQKFETSRLFVRETTR… |
| A0A1D2A5X2 | 38-212 | PHALDAAAASARVVKAALAAGLYPNLLRVDAPPPKFQRVHGGTAQIDADPAELRFHDRSRGRVFLHPSSCNFGAGRFPSGWLVYSDI… |
| A0A194UN98 | 497-752 | None |
| A0A7S4RFU5 | 403-548 | None |
| A0A7R9KTS9 | 15-203 | None |
| S7QNS4 | 59-227 | None |
| A0A7S2S8U7 | 9-183 | None |
| A0A7S2UMA7 | 4-153 | None |
| A0A287IH84 | 22-148 | None |
| A0A2G2WQC3 | 124-298 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.