DPCstruct | MC60820
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 164 ± 33 aa |
| Standard deviation of domain lengths | 32.98 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02669 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N8M885 | 1-204 | MFDIVSGALRVSLVTFVLCGFAYPFAVTVLGQLLTPFQAHGSLATNADGVVVGSRLIGQNWMDPKWFRGRPSATTDTDPNDSTKTIP… |
| Q8X9G0 | 5-188 | RPALSTFIFLLLITGGVYPLLTTALGQWWFPWQANGSLIREGDTVRGSALIGQNFTDNGYFHGRPSATAEMPYNPQASGGSNLAVSN… |
| F4KRA8 | 3-186 | None |
| A0A258TWW0 | 9-167 | None |
| A0A0H3JK46 | 1-123 | None |
| A0A1I7Y2R5 | 375-572 | None |
| A0A1V4TRG9 | 17-199 | None |
| X8DPG8 | 2-143 | None |
| A0A5J4KYG7 | 6-140 | None |
| A0A7I8EXI0 | 30-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.