DPCstruct | MC6082
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 78 ± 7 aa |
| Standard deviation of domain lengths | 6.53 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 39.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00173 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8CX13 | 29-109 | ELTSWGTSVTSDPLTFGTGRVIGRFYGEDGLPTPELTQVEAMITKGLEANKQELKEKQKFPPCNAEWSAARGGRFWCSQTR |
| A0A7S3Z7E8 | 7-86 | AAIEQWRKFYADHKTYTFAGKLIGPFYDQNGQPTETLQRVRHGVKEHDQFMELQRAQEQLFTKCNSNWSQAEGGYVWCAD |
| A0A4Z2HHJ1 | 86-151 | None |
| A0A835NXS8 | 105-181 | None |
| A0A1B0AV97 | 118-197 | None |
| A0A6L5CLS6 | 55-130 | None |
| A0A2R7VYE6 | 47-131 | None |
| A0A2A6CHB1 | 1041-1118 | None |
| A0A2K5D468 | 3-79 | None |
| A0A3B3DC79 | 3-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.