DPCstruct | MC60817
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 79 ± 8 aa |
| Standard deviation of domain lengths | 7.87 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 93.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 57.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T7M8S0 | 1130-1208 | YGQRPGAYNYRSGGTYQIAYHPRRSCGSAPVTIQNRATAALYNYTPYQPNAAALRNMDGEGDSCSAYGNRNFWRTYNSW |
| A0A2A2EJV6 | 297-377 | YVRHEDRYGFHAGRLNFVRFNPDVACGGANVYIENKATALLYIYTPYQPNDAALAAGAGEGDDCSTYGNRNFSIIYSNWFG |
| A0A7T0KI13 | 762-844 | None |
| A0A1G9SM59 | 305-372 | None |
| A0A3E0VY60 | 164-252 | None |
| A0A7T9QM39 | 184-267 | None |
| A0A4Y3UQZ3 | 133-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.