DPCstruct | MC60813
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 203 ± 31 aa |
| Standard deviation of domain lengths | 31.01 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 29.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02696 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X5BBZ7 | 9-195 | LTNRYHALPKVFYREVMPQPLDNPKWIAWNAEFATQFGLPDQPDQELLVCFSGLQMPESFKPLAMKYAGHQFGVYNPDLGDGRGVLL… |
| A0A6N3QTW3 | 4-171 | SFVTRWRDELPETYTALSPTPLNNARLIWHNIELANTLSIPSSLFKNGAGVWGGEALLPGMSPLAQVYSGHQFGVWAGQLGDGRGIL… |
| A0A383SQB6 | 1-206 | None |
| A0A149V5Q4 | 9-188 | None |
| A0A177WJG7 | 64-230 | None |
| A0A376EN99 | 3-214 | None |
| A0A3T0K8A6 | 1-206 | None |
| A0A2D6K6N8 | 242-430 | None |
| A0A1F3Y9R8 | 37-254 | None |
| A0A258W0S0 | 14-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.