DPCstruct | MC60812
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 128 ± 11 aa |
| Standard deviation of domain lengths | 11.13 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 31.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I2YRM5 | 1-105 | MGINGKRHFTYQDLQQTLNFSGAEIGQADNEIGTLVTVTIRMTVDTGGTTFRILLPRINIPGEQMVSVRTIGITTLHRFSIVPASGQ… |
| W4ME80 | 19-142 | EANMFELDSGKIQVSYSATTIAGVPSLTYRDRNQQQTFQGNAIHIEDTSIGQLVSVTLEHIPDLRIVTFTLILPAVYVMPVSMGVSV… |
| A0A0E3SKJ2 | 27-172 | None |
| A0A838VJA4 | 23-157 | None |
| A0A537XNG3 | 5-128 | None |
| A0A2T1EN29 | 12-137 | None |
| A0A7W1K789 | 7-128 | None |
| A0A1G5TDG6 | 77-207 | None |
| A0A328Z696 | 128-270 | None |
| A0A2R5FXC8 | 3-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.