DPCstruct | MC6081
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 87 ± 4 aa |
| Standard deviation of domain lengths | 3.99 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 77.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 54.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14653 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q6B9Z1 | 30-116 | CQPAPRCGEWTYNPLEQCCDDGVILDLNQTRLCGSSCTFWPCFQHCCLESLGSQNQTVVRFKVPGMKPDCKSSPITRICAQEYHPKS |
| A0A7J8C7X9 | 31-114 | GAHLMLCQSHTRCGDKFYDPQQHCCYDDAVVKLSETRKCGNCTFRVCFEQCCPWSFKSEETFLVKVKSQNCSSGLFSDDRVCSR |
| A0A6P6CU56 | 9-95 | None |
| A0A6B0S3T3 | 31-123 | None |
| A0A834DEM7 | 24-111 | None |
| A0A7N9CG00 | 82-172 | None |
| Q6B9Z0 | 39-121 | None |
| L5KPF0 | 1-79 | None |
| A0A452FSB1 | 53-143 | None |
| A0A2Y9GCH1 | 2-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.