DPCstruct | MC60807
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 90 ± 11 aa |
| Standard deviation of domain lengths | 10.93 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 41.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A318Z4L2 | 1-88 | MARSYGITDPTLVLIGTNNSGEMGYIITANGRYYSGHLLVDYIFEITAPKTWPDILDVMRAKGIMGLKMKELKPVELPDDDDLPAPRV |
| A0A0F0IMP3 | 33-112 | AKRCGLENPEAIMCTTPESGEHYGLISDRGRYYFTDDLAWSLRETLKPVTLDGIVEKILDDKEYTIKTKALRAVETAEDR |
| A0A1L9UU35 | 59-153 | None |
| A0A397GYR3 | 33-133 | None |
| A0A5N6Y0G9 | 116-188 | None |
| A0A0K8LJQ0 | 213-299 | None |
| A0A1L9UEJ3 | 44-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.