DPCstruct | MC60806
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 125 ± 24 aa |
| Standard deviation of domain lengths | 24.48 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 25.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A421BBL7 | 297-420 | VVTVARVPYLPNSRAGEDVLAVDAAEPDPVLRANAEIVVHPNADDPAAWVAEAIATSHCALAVAAGDRAHFAWYTGQTWTADVPGLA… |
| A0A1B2HDS0 | 24-134 | HLVVHTNDPSETALQLADIVVHDEPGETAEWLAHTLASLPGTAVVTRPISDAAWLAGTRDGHQIRFDHAGTFGPARASIALTWTTSG… |
| S3ZLS9 | 41-142 | None |
| A0A1Q9SFW2 | 31-158 | None |
| A0A291QBX1 | 57-184 | None |
| A0A4Q7KDA6 | 319-453 | None |
| A0A371Q619 | 73-223 | None |
| A0A221W600 | 4-123 | None |
| S3B986 | 4-163 | None |
| A0A419HHB0 | 2-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.