DPCstruct | MC608
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 90 ± 5 aa |
| Standard deviation of domain lengths | 5.41 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7ELS9 | 20-109 | NRAKSTGRPILCTECLARTFKNEMTGFLPVYRKERIGFYIWGLCAGSAQYHFPWDWPIGSPEPKRWFHCVMYPDGSFYDQTEYEMVQ… |
| A0A661MME8 | 198-290 | LVADLQQYGRPVLCTEYMARSVGSTFQTILPIFDEENIGAYNWGLVSGRTQTIYTWLSWVTMDPADADPWFHDIFHPNGTPYDPQET… |
| A0A815ZT78 | 8-99 | None |
| A0A497JYD3 | 1-75 | None |
| A0A3N5SYT4 | 271-361 | None |
| B7FV50 | 309-402 | None |
| A0A5C5YFP1 | 293-385 | None |
| A0A485D540 | 50-143 | None |
| A0A377M7Y4 | 258-355 | None |
| A0A318ULJ4 | 227-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.