DPCstruct | MC60798
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 67 ± 6 aa |
| Standard deviation of domain lengths | 5.89 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 42.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V1C863 | 1-79 | MCTYQYMEYSCGHCRTIVSEWCSRYRGALQSHIRCRPEIRYHTTNDSLCSYCKEQQMPKPAWMPPKPQEGSRTYVGLYK |
| A0A084FWT1 | 2-63 | QIELKCGHIKRIVEAWCEDYCKTEIRCPPNIVHWEYRVDSVCRGCRPPKPLPPQWEAMIRRD |
| A0A6G1G7F3 | 1-74 | None |
| A0A5M8PQD6 | 2-73 | None |
| A0A2P5HXG8 | 2-65 | None |
| A0A2J6R913 | 1-67 | None |
| A0A3M9XX29 | 1-71 | None |
| A0A5N6KLU0 | 1-60 | None |
| A0A4S9R4N8 | 2-62 | None |
| A0A1S1W046 | 15-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.