DPCstruct | MC60797
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 188 ± 15 aa |
| Standard deviation of domain lengths | 15.38 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R7CAL3 | 24-224 | SLYLMNGGKLGRLGRNRIEDLAYYYDNLKKYVENVNQLLYRYVGGQQRISEFIKHLGGSGKIHGCIVDVERPNELEGFSYCHLFVNP… |
| A0A6N9PA84 | 98-266 | GNLTMLNGGAMKSLFIPDISYYYERMDNIISYIRQPLDKFSEIQKQIANTVKKIGGLGTIHGAIIDIDYFNHIYVNPTDGTITGYWA… |
| A0A7S7M872 | 743-943 | None |
| A0A1H9BDJ2 | 413-607 | None |
| A0A416DSJ3 | 666-866 | None |
| A0A3A9SF11 | 671-844 | None |
| A0A7J5SCU1 | 191-368 | None |
| A0A6B9T717 | 431-613 | None |
| A0A348VXY4 | 804-987 | None |
| A0A3F3PCS9 | 507-732 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.