DPCstruct | MC60793
Metacluster Properties and Pfam Annotations
| Number of structural domains | 2045 |
|---|---|
| Mean domain length (aa) | 202 ± 39 aa |
| Standard deviation of domain lengths | 39.28 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.39 |
| Mean intra-cluster sequence similarity (%) | 11.18 |
| Pfam Score | 72.70 |
| Assigned Pfam label(s) | CL0219- PF14951- CL0010- PF01250- PF07833 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A7GE45 | 32-212 | GKFVPDTRKGRVKGPVKDKRIYRDRGYCRLVVETEDGDVNVYFWDEAYEVALNDIFPGMDVEVEASRGESGYHVRSAELVRVEVDES… |
| A0A7X6ZFQ4 | 6-193 | IVKATIAEFIAAAVGDTQYRLTGVITSIANGTYGNLYVRDFSGEVYVYGIKDFKDKDLKVGDIITIVGKRAEYKGTPQVGGAVLESK… |
| A0A532E8A4 | 75-229 | None |
| A0A1Z3HTB3 | 1-236 | None |
| A0A1R3KMX0 | 3-220 | None |
| A0A1R3KN73 | 634-867 | None |
| A0A7S2CW83 | 7-177 | None |
| J8G8V2 | 17-198 | None |
| W1I7R5 | 181-354 | None |
| A0A812MBX3 | 21-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.