DPCstruct | MC60785
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 120 ± 21 aa |
| Standard deviation of domain lengths | 21.07 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 91.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 39.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E5Q4B0 | 25-124 | SFYKAKKLLYKEIYKDHNKTFYCGCSYTGKVVNLESCHYKVRKDTKRAKRVEVEHIVPAYWIAHLTEKGRACWNKGKKLKGIGGRKY… |
| A0A3D6E245 | 2-91 | EDDFYCGCHYVGHVVQLASCGYQPRKNPTRAARIEWEHVVPAWVLGHQRQCWQQGGRKHCTDTDAVFQRAEGDLNNLVPAVGEVNGD… |
| A0A3M5PGU8 | 129-262 | None |
| A0A2W4MBA5 | 15-142 | None |
| A0A2E8PPP1 | 41-216 | None |
| A0A378JQA8 | 5-130 | None |
| A0A5E6XB86 | 2-91 | None |
| A0A376FGR1 | 16-126 | None |
| A0A378BQS8 | 7-106 | None |
| A0A1H7AJA7 | 12-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.