DPCstruct | MC6078
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 56 ± 4 aa |
| Standard deviation of domain lengths | 4.22 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 38.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G4F5D7 | 9-62 | YKQRLCCWAIARLLPSEQWIIVARFRSRSDADGHFQFLRQTIPHVKFEVVFDLS |
| A0A0P4US72 | 2-51 | QLHPWCIIRLLPNLQRSVVQRFRKRSEAEEYLKALKRLLPEASHQIVFDP |
| F4XND0 | 34-88 | None |
| A0A3S1AKV9 | 91-149 | None |
| A0A3S1D5F4 | 3-59 | None |
| A0A350XFQ1 | 7-63 | None |
| F4XR13 | 21-76 | None |
| A0A6P0JZY1 | 19-73 | None |
| A0A6P0WPA4 | 7-62 | None |
| A0A3C0N9K4 | 120-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.