DPCstruct | MC60779
Metacluster Properties and Pfam Annotations
| Number of structural domains | 104 |
|---|---|
| Mean domain length (aa) | 180 ± 28 aa |
| Standard deviation of domain lengths | 28.01 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 23.78 |
| Pfam Score | 98.39 |
| Assigned Pfam label(s) | CL0713- PF00173 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4PGY8 | 26-203 | AIDKLIKTNVYSYYLVYFTLTVFFITQSIRHYSWGHVTSGIAGGLIIWSLTEYTMHRFLFHWNPRNLFEKVLVYALHDVHHAYPRDV… |
| A0A7Y3DAM5 | 2-142 | WPFQEWLIHVYILHYKPVRFAGRTWDFPVPRKHRAHHADPWRLDLLFIPPHVFVYGLPLHLLFWFGLMPTPAIACSGLLAYFVLALH… |
| A0A6C0JF54 | 10-173 | None |
| A0A418PSD1 | 12-188 | None |
| A8JGN3 | 5-163 | None |
| A0A0B7NEZ8 | 690-891 | None |
| A0A1V2LN82 | 654-842 | None |
| A0A7S1UZD7 | 37-193 | None |
| A0A7C3ML64 | 22-170 | None |
| A0A523E9K1 | 13-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.