DPCstruct | MC60773
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 227 ± 21 aa |
| Standard deviation of domain lengths | 21.48 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 21.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A317BAG7 | 9-221 | FRLMDLPLELFQQIIYETILARGRKRGLRLMLVNRFFREQVRYVLCMNSMLDGAWPYQGEYSMVQSYLEYWVNTEPRDGNRILVIIR… |
| A0A1E3B2M8 | 1-239 | MASRMSLQNLPVEIFNHIIESLVASVGIFKAVRLRSVNTRFNSAIWFAICTRQVIDIKDPAIPGLYLYMPTSLKGRILLSKSYSQEA… |
| A0A4P7NR49 | 2-267 | None |
| A0A6A5Y4H6 | 1-248 | None |
| A0A517L7K8 | 1-220 | None |
| A0A135S2X2 | 1-244 | None |
| A0A2W1DW20 | 5-195 | None |
| A0A0C4E1C7 | 74-293 | None |
| A0A6A6E6W4 | 6-229 | None |
| A0A6A6SKR2 | 61-298 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.