DPCstruct | MC60771
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 82 ± 11 aa |
| Standard deviation of domain lengths | 10.71 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 92.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 50.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0277 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E3B0J6 | 4-97 | MHHIVCIAFNRGDPESKRKAHWLIKTLIADCAEHGWGEYRTHLALMDQIAETYNWNHNALMRFNETVKNALDPNGILAPGKNGVWSS… |
| A0A4Q4VER2 | 122-199 | DTARRRAALDCLRCKIDDAAAHGYGEYRTHLVLIDQVAGTYNWNDDALMKFNEKLKDALDPNGILAPGRCGIWPKRYR |
| A0A1V8TYV8 | 1120-1199 | None |
| A0A1V8TZ80 | 849-925 | None |
| A0A4Q4R2G9 | 15-108 | None |
| A0A824APM8 | 2-75 | None |
| A0A420XXL4 | 506-584 | None |
| R1G5W2 | 304-386 | None |
| A0A395IIH3 | 290-371 | None |
| A0A084G3T9 | 924-997 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.