DPCstruct | MC60768
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 160 ± 25 aa |
| Standard deviation of domain lengths | 24.91 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07907 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A535R8X4 | 322-487 | GTLGTLVLVVALAAAAIGIARITGLGTEDAIFVFVGTAGKVDMPRLVLAGVVVASLGALVDMAVGQASTAFELSAAGELRGRRLYVS… |
| A0A844EDB1 | 10-178 | ILIVVIIIPVEYWAQVGGFGLEDSEELEGLSTYVGINFTKVAIATAILSSLGAVAEAAIAISSGLDEIVTQHKEITSSQLFLDGTII… |
| A0A538JBC5 | 1-144 | None |
| A0A369B2S8 | 1-189 | None |
| A0A7W7FUJ1 | 247-396 | None |
| A0A7Y3CUQ1 | 146-296 | None |
| A0A261CT94 | 251-406 | None |
| A0A1W9VU44 | 23-197 | None |
| X1BPU9 | 2-109 | None |
| R6P6U8 | 200-369 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.