DPCstruct | MC60762
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 155 ± 21 aa |
| Standard deviation of domain lengths | 21.01 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10744 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A131YXA5 | 1-147 | MAKALRMAIMEKHHLVDSAERSQLQKCLDMIQKSIKVTSMQSMIERLDTITRQQGLMFTTGPGGQECFISSDMFYVEVLLEPSGTVN… |
| E3LM57 | 1-168 | MIIEERKSYESNLESIDSDLRLENVRQNAEKLGWDHFARSVRRNLQEKRQTLEARIRLDVLGSLAFMKEHLPIDKEASVTRKLQYFA… |
| A0A151P277 | 67-175 | None |
| A0A3P8SSM2 | 2-168 | None |
| A0A4Y2LEG1 | 28-183 | None |
| Q614K9 | 22-197 | None |
| A0A0M3ITW4 | 14-150 | None |
| A0A2H2I8P3 | 23-177 | None |
| A0A369S705 | 45-187 | None |
| A0A0L8HLZ9 | 1-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.