DPCstruct | MC60758
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 82 ± 4 aa |
| Standard deviation of domain lengths | 4.03 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 94.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 44.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4TZU9 | 1-75 | MLAMHRMLTRTPSKVLNATLTDAVGDRRTQNLPGTTNEYPNWRVPLSHPDGSPMWLDEVFTDERAARLSHVMNEK |
| A0A7Y0DAI3 | 71-150 | ADPSERELVEALHRLILATPAALIGVSLADAVGERRAQNQPGTDQEYPNWKVPLANGAGQVVLIEELFSNPRLRSLAATL |
| A0A6J7R075 | 2-80 | None |
| A0A7X3AK40 | 398-481 | None |
| A0A7X9CTR7 | 1-88 | None |
| A0A060BWB6 | 38-117 | None |
| A0A838SW63 | 37-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.