DPCstruct | MC60757
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 87 ± 9 aa |
| Standard deviation of domain lengths | 8.65 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.84 |
| Pfam Score | 98.21 |
| Assigned Pfam label(s) | CL0036- CL0118 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4TY50 | 5-93 | SNLVAESVERLRRDKPLVQCLTNIVVANFTANVLLSAGAVPAMVDNPEESEGFASIADGVLVNTGTPYRETAEAMIAAARGAASSNT… |
| A0A2V1GXL9 | 8-97 | LAQQIADNLLQLRQQAPLVLNLTNYVVMNNSANALLAIGASPIMAHSRCELAEMVRICGSLVINIGTLDETWVDRMKTAAQFAVSAD… |
| A0A7J6Q3B4 | 394-479 | None |
| A0A0F7SUP9 | 319-401 | None |
| A0A1Q9DYJ9 | 139-230 | None |
| A4S5G2 | 5-94 | None |
| A0A2A5SWZ9 | 4-88 | None |
| A0A381H102 | 7-95 | None |
| A0A806G8R8 | 11-98 | None |
| A0A199VZ58 | 9-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.