DPCstruct | MC60756
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 93 ± 8 aa |
| Standard deviation of domain lengths | 7.67 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 42.84 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | PF17392- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y0RQH2 | 83-173 | SELVERNITPDVVTDQTSAHDPLNGYLPQGWSMSHAAEMRLQDEAAVVKAAKKSMAVQVQAMLDLQSRGAATLDYGNNIRQMALEEG… |
| A0A7J7AU78 | 30-123 | KSRKYCGGHIDQTSLHNPWAGGYYPAGISFDESNRMMTENPELFKAKVQETLCRHAEAVNRHAAKGTYFFDYGNAFPFEASRAGADV… |
| A0A090P2L6 | 77-166 | None |
| A0A268IJV5 | 1-92 | None |
| R7T502 | 232-333 | None |
| A0A447MVJ3 | 46-144 | None |
| A0A2G9URQ4 | 56-135 | None |
| A0A380H1J8 | 122-212 | None |
| A0A7W1B8W2 | 29-119 | None |
| A0A0B7A9P5 | 42-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.