DPCstruct | MC60755
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 106 ± 10 aa |
| Standard deviation of domain lengths | 10.08 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.48 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0599- CL0158 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4TTQ0 | 3-99 | AHDLEHARANFQDKGRSNSSLVPFGYGDGGGGPTREMLAQARRVADLDGSPKLAIEPPATFFSRAESEHEDPGTWVGELYLELHRGT… |
| A0A2S8DD28 | 51-174 | MHNFPEDTYDSRARARSLEYIEQNYNEKEICPYALMVYGVGDDGAGPGEEHIERLTRIRNIDGLPHVDFSRVDKFFTYADAFRESLP… |
| A0A2J2H5W5 | 123-216 | None |
| W4UI82 | 41-141 | None |
| A0A6L4LDF1 | 78-189 | None |
| A0A0R1W748 | 86-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.