DPCstruct | MC60752
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 161 ± 25 aa |
| Standard deviation of domain lengths | 24.90 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0493 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W6AFV6 | 532-708 | SGIVEPIQLSGLIENQEALAQGLDPKFVFTNPFMNNFIHIGGTGGTIMLIFAIMVFSKRSDWRAMAKMTIIPALFCVNEPLLFGLPL… |
| A0A645EGG5 | 37-213 | NGSLLDPLLLVNMNENMAAANAGEDAPNIINSAFVTVFTQMGGTGGTFALILAVLLFVKYKPYKDVVNLSLAPGLFEINEPIIFGLP… |
| A0A357QZF6 | 211-392 | None |
| B1MZ09 | 182-366 | None |
| A0A5R8QIE3 | 338-517 | None |
| A0A858ARE2 | 590-777 | None |
| A0A116R1B7 | 19-192 | None |
| A0A0R1QWJ5 | 16-203 | None |
| A0A5J4J6F7 | 20-178 | None |
| A0A645HF42 | 3-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.