DPCstruct | MC60744
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 72 ± 10 aa |
| Standard deviation of domain lengths | 9.75 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 45.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01422 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6FEF4 | 65-126 | ERCHRGPCDGTCRLVVTKACRCGGLKKEVPCYQELTCERKCQRLRNCGRHACKRRCCAGDCP |
| A0A3Q7GT95 | 347-412 | ERCHRGPCVETCRLVVTKSCRCGSYKKQVPCHQHMTCERKCQKLRDCGKHACKRRCCDGDCPPCSE |
| A0A2N9GLF1 | 356-417 | None |
| A0A804QIW2 | 378-439 | None |
| A0A5K3ENI2 | 56-128 | None |
| A0A1E3IZZ3 | 775-852 | None |
| A0A183E1Y7 | 259-349 | None |
| A0A445JV58 | 1-83 | None |
| A0A158QE04 | 485-557 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.