DPCstruct | MC6074
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 92 ± 14 aa |
| Standard deviation of domain lengths | 13.52 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 27.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A4X0R8 | 8-90 | HEKVTDEIGNTIEIKLWKIPSTPEKPHGFKYSLAYVEAGKRVIGYDNAEQKGDHRHYGRKEEPYTFTSLRQLTKDFMADVAQF |
| A0A4R6Z513 | 3-88 | VRVDWCDETPGRPQGISYGLVLNDELSERILGFDNSHQFDGASPGDPFDHEHRPGKTGQRFRYDFVSAPQLWDDFLDRVEQHCERA |
| A0A1F3Y571 | 1-98 | None |
| A0A1F3Y6E6 | 9-94 | None |
| A0A534HF26 | 3-80 | None |
| A0A7C3CV66 | 1-107 | None |
| N1NNU7 | 3-88 | None |
| A0A1V5C908 | 43-127 | None |
| A0A1V5C285 | 1-67 | None |
| A0A0H1SAR0 | 6-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.