DPCstruct | MC60738
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 229 ± 57 aa |
| Standard deviation of domain lengths | 57.02 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 86.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 15.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A142HHZ2 | 36-251 | LNTFLLGEPNHLTITLHPPKGAARPPAGAFVIFNINAFGRERTSKPELVYHYEWRQTNPAKPLPATIHAVLPPVVRAGPLSWQAAPK… |
| A0A3M7LK87 | 1-140 | WRWVDATPIREDNPEQMKQLYRAYSNLIELMEKRDFEGLKMAYSLSMREHAKADGYFAKPEDFYDAVEFEDTFATYPDAKVKPRRDW… |
| A0A378RYH8 | 172-448 | None |
| W0BXH4 | 7-244 | None |
| A0A6H0KNG4 | 2-200 | None |
| A0A1F9WV90 | 384-613 | None |
| A0A2S8ACG6 | 17-273 | None |
| A0A5B0X9H9 | 30-199 | None |
| A0A2T1A7G2 | 70-311 | None |
| A0A2T1A8R8 | 464-773 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.