DPCstruct | MC60736
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 157 ± 12 aa |
| Standard deviation of domain lengths | 11.97 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 45.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V7IEA7 | 4-187 | NPNSAIQRMKNHLSYKLGQELIAFDTGGGGVSSLLFKLYLIKKTHKKHLKIYQQITEVFPELRRIPLEQCSDYKQGLECQFHLSYLL… |
| A0A824I6P8 | 1-159 | MGGYIALFKKLYKIKKQHKKEQKIYQQTIQVFPQLKYPSLEACSDYEQALKYKFHLSYMLGEVLIKAYQTWYKGSGFKLKNDIKKAK… |
| A0A824MMD1 | 2-155 | None |
| A0A823U6T1 | 1-148 | None |
| A0A824KRI9 | 2-144 | None |
| A0A0A8HWL3 | 11-169 | None |
| A0A2U8FC03 | 18-176 | None |
| A0A824ADH9 | 37-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.