DPCstruct | MC60735
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 144 ± 15 aa |
| Standard deviation of domain lengths | 15.40 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A3RPD0 | 105-220 | GYVVNQIYLGAGDPDYAERAYIWGTTRFKIAEGAEFVVSADGSREIRNFAIVPDGDENFDFEGGADSAIGNAALQPIIDPSKIGRTV… |
| A0A5S4EPI9 | 111-251 | DFVIQQYTLADTTDDYRVRCYVWGTGGFGLSPEATFTKDANGNLRIDNYQIRAFHDNFDFDGKGDIAAKGNAILQPRIDPSKIGRTV… |
| H8GI81 | 69-223 | None |
| A0A7D5SEZ0 | 21-171 | None |
| A0A5C0DU18 | 97-236 | None |
| A0A179CZE2 | 105-218 | None |
| A0A433UXI9 | 97-235 | None |
| A0A2S6HGB5 | 108-257 | None |
| A0A377R2L6 | 127-291 | None |
| A0A844GG50 | 101-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.