DPCstruct | MC60728
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 138 ± 23 aa |
| Standard deviation of domain lengths | 22.84 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 75.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20150 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q0UGU5 | 1-132 | MSFEAFRFLELPAQLRCMVYEDLKIETRRHVFKMSEALECKHWTVADGAHRSITLVRKLLAVAILATCWQVQCEVVEYLRSRLRDLK… |
| A0A7C8I409 | 7-84 | SPSPFRFMDLPISVRCIVYNFLPRTVKQCHIRDIGPKGRIMTTLIVKLIPVSILATCKLIHAEAKPILERLREDFFFR |
| A0A6A5VAL6 | 2-97 | None |
| A0A6A5X2H6 | 1-147 | None |
| A0A6A5ZPW3 | 7-158 | None |
| A0A6A5U8S2 | 1-142 | None |
| A0A178ABA6 | 56-182 | None |
| A0A178ADA6 | 12-167 | None |
| A0A2V1DY72 | 51-197 | None |
| A0A6A6ZF51 | 5-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.