DPCstruct | MC60727
Metacluster Properties and Pfam Annotations
| Number of structural domains | 158 |
|---|---|
| Mean domain length (aa) | 218 ± 61 aa |
| Standard deviation of domain lengths | 61.19 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 81.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 15.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q0UFM5 | 35-273 | YHDNTEAMQKKHDDECDVENGNKLKQCFDECFQIKHFDSPAVMLNEDGSRPEKANQYYKAPCGTTMRVKDAAHAVGVNGIGGAVIAM… |
| A0A167YJ69 | 257-506 | MPSYENAGISQLSNYQTAITKKVPDTKIVESEEDVAKEPVNKAFLNIHKIDELQLDTSLMRIDQEAEFSVLKTKFDQSMLGFNMRSE… |
| A0A1V6S523 | 161-426 | None |
| E3R103 | 61-249 | None |
| M3C4F3 | 36-323 | None |
| M3D2G7 | 81-323 | None |
| M3DB06 | 72-290 | None |
| A0A4V1XUU4 | 325-549 | None |
| A0A6A5QP15 | 32-294 | None |
| A0A6A5QTR4 | 3-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.