DPCstruct | MC60724
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 110 ± 9 aa |
| Standard deviation of domain lengths | 8.89 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q0U048 | 3-105 | TSILLPSLLATFASAVCPGANFAVGNVQTTGDTSTWNVYDSQCNVVESLVTKENPCTSGMFGCVGGTFRQYTNSASKLIYDCRKVYD… |
| A0A2P5HMT5 | 3-116 | LLKSTLLDVVVLLGLSGLANAACGGFDLGVTEPRDLGGEMAQYKIYEDDCALSQDLQLNSTTGHCDSRYFVCRPLTTEIYAYDDPVT… |
| A0A6A6UQU9 | 13-124 | None |
| A0A284QNQ9 | 160-267 | None |
| A0A6A6U409 | 17-115 | None |
| A0A423WB41 | 6-109 | None |
| A0A3N4LHJ6 | 1-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.