DPCstruct | MC6071
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 162 ± 17 aa |
| Standard deviation of domain lengths | 17.24 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11810 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A4SY80 | 42-211 | NFMKSICWLLAGCLLSLTTAGCYGKFGLTRAIYRINGSIGDKWVNSIVTWILLIIPVYEICGLVDFLIFNVIQFWTGSNPVAMGPED… |
| A0A4Z0ZMS6 | 2-153 | KKFLKTALVGLLSFGLLSNCFGKFGLTKAIYSINGNIQIGTGKVAGFFRSLLMIFPFSIAYYVGGVLDVLIFNLIEFWTDRNPIAMS… |
| A0A3A8QF62 | 8-174 | None |
| A0A2E5S005 | 3-172 | None |
| A0A3D1R9X1 | 1-138 | None |
| A0A2D7PQM9 | 1-157 | None |
| A0A1F3XV97 | 1-201 | None |
| A0A0E3VQQ1 | 60-241 | None |
| A0A6C2UDN5 | 10-168 | None |
| A0A416G6W4 | 6-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.