DPCstruct | MC60704
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 366 ± 64 aa |
| Standard deviation of domain lengths | 64.46 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.20 |
| Pfam Score | 97.37 |
| Assigned Pfam label(s) | CL0020- CL0242- PF07889 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812K384 | 9-362 | GTLRPQLARDLRDTGLGLGYPTAERAKGFLLEKAQFQSRDSISHFALRLAFCKANEAREWLLKQEQRLFVLRFEGSNLGASWQAFVE… |
| A0A662SM16 | 3-312 | ISRYPFSKEAAELVQEEGYNIEDLAYHPDLAKARERALKRLFSSIEGRIDITIDEIRPMNDVYSFLISRIIVERIGDRFLKNRFAEH… |
| U6L5H0 | 23-396 | None |
| A0A1Q9DT86 | 181-429 | None |
| A0A2T7PZX1 | 6-407 | None |
| A0A7J7M0V6 | 30-393 | None |
| A0A7R8HBX6 | 2-292 | None |
| H0EWT1 | 3-392 | None |
| A0A2A3E9X4 | 366-813 | None |
| A0A0V0T7X6 | 5-472 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.