DPCstruct | MC60703
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 239 ± 39 aa |
| Standard deviation of domain lengths | 39.43 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 71.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 28.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812J843 | 1-262 | MQQGVRDVPVVTPAQPKSLASRKQVHGLDDESFRLCRRHKPLLGEVALNTTTVQSTKGRSSNFEQCDARKEFRLFQPLRSAPFFKTS… |
| A0A812ZEL4 | 3-330 | EQRNEERLEMIEEKMDKMTEARSLNGQGSESVGPVSPVRPGFRSETQSLFQGCARREVARQVAKERKHSARTRAIARAVQQTCGPDY… |
| A0A812IQ21 | 21-247 | None |
| A0A812L5P3 | 1-210 | None |
| A0A812Y000 | 48-304 | None |
| A0A812HSS3 | 92-299 | None |
| A0A812JPE4 | 661-957 | None |
| A0A812P8R2 | 63-283 | None |
| A0A0G4HD90 | 12-255 | None |
| A0A812RZE8 | 106-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.