DPCstruct | MC60701
Metacluster Properties and Pfam Annotations
| Number of structural domains | 146 |
|---|---|
| Mean domain length (aa) | 186 ± 31 aa |
| Standard deviation of domain lengths | 30.74 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 35.83 |
| Pfam Score | 86.81 |
| Assigned Pfam label(s) | PF00521- CL0110- PF16898 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812IFY5 | 151-340 | FVDKELVLFAKANVARAIPSMVDGFKPSQRKVLFGCFKRKLRHDVKVAQLVGYVSEHAAYHHGEMSLSETIVGMAQDFVGSNNINLL… |
| A0A6J0SIK9 | 2-162 | VDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEASLMMTIINLAQNFVGSNNLNLLQPIGQFGTRLHGGKDSASPRY… |
| A0A816VFU0 | 7-188 | None |
| A0A7R9PU81 | 119-273 | None |
| A0A535VXI0 | 414-607 | None |
| A0A0K0EEJ7 | 397-590 | None |
| E9GC34 | 5-168 | None |
| A0A521F3Y2 | 9-207 | None |
| A0A1I8FBP6 | 30-215 | None |
| I0X5W3 | 21-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.