DPCstruct | MC60689
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 59 ± 4 aa |
| Standard deviation of domain lengths | 3.99 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 48.16 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | PF10267- CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D2F5S9 | 3-61 | KRGRACVVVLGDLGRSPRMQYHALSLARQASLEVDIVAYGGSEPHSAVIENESIHIHTM |
| V9ILJ8 | 28-85 | HKNVCIIVLGDLGRSPRMQYHALSFAKEGFTVDIIGYPGSIPLREIRENPCIHIYYLY |
| A0A3P7K9X5 | 71-125 | None |
| A0A7R9J9W6 | 33-91 | None |
| A0A7R8CCK5 | 369-425 | None |
| A0A6P7TXB2 | 20-78 | None |
| A0A5N4CW67 | 32-88 | None |
| A0A4Y7JSK3 | 9-68 | None |
| A0A507FHP2 | 37-106 | None |
| A0A4Q2DC36 | 37-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.