DPCstruct | MC60685
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 62 ± 2 aa |
| Standard deviation of domain lengths | 2.47 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 93.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 41.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A165GUE3 | 48-109 | DEKLAEEIISLWPATPKAAAETMVKFYGQPNEATVNRLTWYNNGPWKRTVVFKEEIPHDFPE |
| A0A179T2F9 | 6-67 | KLYVDEILKTWQEKLREGAFKLINKYGYPDEASASKLIWYNNGDWKRTIAHRDAITYLLSNN |
| A0A7Y5TSW6 | 3-59 | None |
| A0A7W1L2Y1 | 101-160 | None |
| A0A7V9Q7B0 | 38-102 | None |
| A0A838TSX5 | 34-94 | None |
| A0A7V9GKJ7 | 22-86 | None |
| W0K400 | 11-73 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.