DPCstruct | MC60681
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 326 ± 35 aa |
| Standard deviation of domain lengths | 34.88 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 28.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09744- PF11461 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q2Y6A0 | 21-363 | SSLTVDDVYEIAKVIGVELEKLIDGYGKESVLGLVPRVVKVLELLESFTARNHAHKHREEELLRTFESLKMQQKKWAAKDNDEVNEN… |
| H2UV14 | 5-310 | EERSDGCFDGPVSALTVDDVYKIAKAIGTDVEKLIDACGKESVVGLVTKTVKVLELLESFASRNNAHTLREDELLKTFETIQLQQQK… |
| A0A819TPN1 | 57-360 | None |
| A0A1A8KFU7 | 3-277 | None |
| A0A1I8HP26 | 1-341 | None |
| S4S041 | 1-326 | None |
| A0A443R141 | 8-338 | None |
| A0A816R1X3 | 48-329 | None |
| A0A0K0DXG3 | 17-320 | None |
| A0A813XX06 | 76-435 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.